VPS29 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-186 of human VPS29 (NP_476528.1). |
| Modifications | Unmodified |
VPS29 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-186 of human VPS29 (NP_476528.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-VPS29 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VPS29 antibody: synthetic peptide directed towards the N terminal of human VPS29. Synthetic peptide located within the following region: LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL |
VPS29 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Canine, Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_057310.1; NP_476528.1. |
Goat Polyclonal Antibody against VPS29
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DDVKVERIEYKKP, from the C Terminus of the protein sequence according to NP_057310.1; NP_476528.1. |
Germany
Japan
United Kingdom
China
