Germany
Japan
United Kingdom
China
Vsx2 (N-term) sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Immunogen | A recombinant protein corresponding to amino acids 1 to 131 derived from the N-terminal of the Human Chx10 protein conjugated to GST. |
Antibodies
View as table Download
Vsx2 (C-term) sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Immunogen | A recombinant protein corresponding to amino acids 264 to 361 derived from the C terminal of the Human Chx10 protein conjugated to KLH. |
CHX10 (VSX2) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 262-291 amino acids from the C-terminal region of human VSX2 |
Rabbit Polyclonal Anti-CHX10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHX10 antibody: synthetic peptide directed towards the C terminal of human CHX10. Synthetic peptide located within the following region: ESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKM |
Active filters
Target Symbol
- VSX2