Antibodies

View as table Download

WBP11 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human WBP11 (NP_057396.1).
Modifications Unmodified

WBP11 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human WBP11 (NP_057396.1).
Modifications Unmodified

Rabbit Polyclonal Anti-WBP11 Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WBP11 antibody: synthetic peptide directed towards the N terminal of human WBP11. Synthetic peptide located within the following region: GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK

Anti-WBP11 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 191-210 amino acids of human WW domain binding protein 11