WDPCP (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 679-709 amino acids from the C-terminal region of human CB086 |
WDPCP (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 679-709 amino acids from the C-terminal region of human CB086 |
Rabbit Polyclonal Anti-WDPCP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-WDPCP Antibody: synthetic peptide directed towards the N terminal of human LOC51057. Synthetic peptide located within the following region: LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIPGPINKTTERH |