WDR3 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 208-236 amino acids from the N-terminal region of human WDR3 |
WDR3 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 208-236 amino acids from the N-terminal region of human WDR3 |
Rabbit Polyclonal Anti-WDR3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDR3 antibody: synthetic peptide directed towards the middle region of human WDR3. Synthetic peptide located within the following region: VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT |