Rabbit Polyclonal Anti-WDR4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDR4 antibody: synthetic peptide directed towards the C terminal of human WDR4. Synthetic peptide located within the following region: AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA |
Rabbit Polyclonal Anti-WDR4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDR4 antibody: synthetic peptide directed towards the N terminal of human WDR4. Synthetic peptide located within the following region: FIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRL |
WDR4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-250 of human WDR4 (NP_061139.2). |
| Modifications | Unmodified |
WDR4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-250 of human WDR4 (NP_061139.2). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-WDR4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human WDR4 |
WDR4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human WDR4 |
WDR4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human WDR4 |
WDR4 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human WDR4 |
Germany
Japan
United Kingdom
China
