Antibodies

Jump to Filters
View as table Download
WFDC5 Rabbit Polyclonal Antibody
TA340411

USD 375.00

5 Days

Rabbit Polyclonal Anti-WFDC5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WFDC5 antibody: synthetic peptide directed towards the N terminal of human WFDC5. Synthetic peptide located within the following region: MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV
WFDC5 Rabbit Polyclonal Antibody
TA365156

USD 380.00

4 Weeks

WFDC5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WFDC5
WFDC5 Rabbit Polyclonal Antibody
TA369473

USD 380.00

4 Weeks

WFDC5 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human WFDC5