Antibodies

View as table Download

Rabbit Polyclonal WIZ Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen WIZ antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human TFF3.

Goat Anti-WIZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSYIQGGRPFTKKFR, from the internal region of the protein sequence according to NP_067064.2.

Rabbit Polyclonal Anti-Wiz Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Wiz antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Wiz. Synthetic peptide located within the following region: TSPPGTVKSEEHQRQNINKFERRQARPSDASAARGGEEVNDLQQKLEEVR