Antibodies

Jump to Filters
View as table Download
WIZ Rabbit Polyclonal Antibody
TA319993

USD 430.00

5 Days

Rabbit Polyclonal WIZ Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen WIZ antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human TFF3.
WIZ Goat Polyclonal Antibody
TA305902

USD 375.00

5 Days

Goat Anti-WIZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSYIQGGRPFTKKFR, from the internal region of the protein sequence according to NP_067064.2.
WIZ Rabbit Polyclonal Antibody
TA339533

USD 375.00

5 Days

Rabbit Polyclonal Anti-Wiz Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Wiz antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Wiz. Synthetic peptide located within the following region: TSPPGTVKSEEHQRQNINKFERRQARPSDASAARGGEEVNDLQQKLEEVR