Germany
Japan
United Kingdom
China
Antibodies
View as table Download
WSB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 182-421 of human WSB1 (NP_056441.6). |
| Modifications | Unmodified |
WSB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 182-421 of human WSB1 (NP_056441.6). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-WSB1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wsb1 antibody is: synthetic peptide directed towards the middle region of Rat Wsb1. Synthetic peptide located within the following region: VPWSQCLKNFLLHGSKNVTNSSCLKLARQNSNGGQKNKPREHIIDCGDIV |
WSB1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human WSB1 |
WSB1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human WSB1 |
WSB1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human WSB1 |
Active filters
Target Symbol
- WSB1