Antibodies

View as table Download

WT1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-302 of human WT1 (NP_001185480.1).
Modifications Unmodified

WT1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-302 of human WT1 (NP_001185480.1).
Modifications Unmodified

WT1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WT1
Modifications Unmodified

WT1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WT1
Modifications Unmodified

WT1 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-WT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WT1 antibody: synthetic peptide directed towards the middle region of human WT1. Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA

Wilms Tumor Protein (WT1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 353-383 (E361) amino acids from the Central region of human WT1

Rabbit polyclonal antibody to WT1 (Wilms tumor 1)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 209 and 449 of Wilms Tumor 1 (Uniprot ID#P19544)

Rabbit Polyclonal anti-WT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-WT1 antibody is: synthetic peptide directed towards the N-terminal region of Human WT1. Synthetic peptide located within the following region: DFAPPGASAYGSLGGPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQC

Goat Polyclonal Antibody against Wilms tumor 1 / WT1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QDPASTCVPEPASQH, from the N Terminus of the protein sequence according to NP_000369.3; NP_077742.2; NP_077743.2; NP_077744.3.

Rabbit Polyclonal Anti-WT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WT1 antibody: synthetic peptide directed towards the N terminal of human WT1. Synthetic peptide located within the following region: PASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGA

WT1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WT1.