Antibodies

Jump to Filters
View as table Download
WASF2 Rabbit Polyclonal Antibody
TA315025

USD 345.00

4 Weeks

Rabbit polyclonal anti-WASF2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human WASF2.
Wasf2 Rabbit Polyclonal Antibody
TA339193

USD 375.00

5 Days

Rabbit Polyclonal Anti-Wasf2

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Wasf2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALKFYTNPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRK
WASF2 Rabbit Polyclonal Antibody
TA351922

USD 345.00

In Stock

Rabbit Polyclonal Anti-WASF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human WASF2
Wasf2 Rabbit Polyclonal Antibody
TA356958

USD 360.00

5 Days

Wasf2 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
WASF2 Rabbit Polyclonal Antibody
TA367367

USD 380.00

4 Weeks

WASF2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WASF2