Germany
Japan
United Kingdom
China
WBP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 15-140 of human WBP2 (NP_036610.2). |
Antibodies
View as table Download
WBP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 15-140 of human WBP2 (NP_036610.2). |
Rabbit Polyclonal Anti-WBP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WBP2 antibody: synthetic peptide directed towards the N terminal of human WBP2. Synthetic peptide located within the following region: MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ |
Active filters
Target Symbol
- WBP2