Antibodies

Jump to Filters
View as table Download
WDPCP (C-term) Rabbit Polyclonal Antibody
AP50739PU-N

USD 450.00

2 Weeks

WDPCP (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 679-709 amino acids from the C-terminal region of human CB086
WDPCP Rabbit Polyclonal Antibody
TA335580

USD 375.00

5 Days

Rabbit Polyclonal Anti-WDPCP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-WDPCP Antibody: synthetic peptide directed towards the N terminal of human LOC51057. Synthetic peptide located within the following region: LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIPGPINKTTERH