Antibodies

Jump to Filters
View as table Download
WDYHV1 Rabbit Polyclonal Antibody
TA330828

USD 375.00

5 Days

Rabbit Polyclonal Anti-WDYHV1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-WDYHV1 antibody is: synthetic peptide directed towards the N-terminal region of Human WDYHV1. Synthetic peptide located within the following region: ENIWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWD