Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-WFDC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WFDC1 antibody: synthetic peptide directed towards the middle region of human WFDC1. Synthetic peptide located within the following region: VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF |
Rabbit Polyclonal Anti-WFDC1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WFDC1 antibody: synthetic peptide directed towards the N terminal of human WFDC1. Synthetic peptide located within the following region: WKRALPARLAEKSRAEEAGAPGGPRQPRADRCPPPPRTLPPGACQAARCQ |
Goat Polyclonal Antibody against Wfdc1 (mouse)
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RQRLHKEYPEGDSKN, from the internal region (near N Terminus) of the protein sequence according to NP_075884.1. |
Rabbit Polyclonal Anti-WFDC1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human WFDC1 |
Active filters
Target Symbol
- WFDC1