Antibodies

Jump to Filters
View as table Download
XAF1 Rabbit Polyclonal Antibody
TA344996

USD 475.00

5 Days

Rabbit Polyclonal Anti-XAF1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XAF1 antibody: synthetic peptide directed towards the middle region of human XAF1. Synthetic peptide located within the following region: SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC
XAF1 Rabbit Polyclonal Antibody
TA306145

USD 430.00

5 Days

Rabbit Polyclonal XAF-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen XAF-1 antibody was raised against a synthetic peptide corresponding to amino acids at the C-terminus of human XAF-1.
XAF1 Rabbit Polyclonal Antibody
TA344995

USD 475.00

5 Days

Rabbit Polyclonal Anti-XAF1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XAF1 antibody: synthetic peptide directed towards the middle region of human XAF1. Synthetic peptide located within the following region: RSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDIL
XAF1 (C-term) Rabbit Polyclonal Antibody
AP23340PU-N

USD 405.00

2 Weeks

XAF1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human XAF1
XAF1 Rabbit Polyclonal Antibody
TA306193

USD 430.00

5 Days

Rabbit Polyclonal XAF-1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen XAF-1 antibody was raised against a synthetic peptide corresponding to 16 amino acids near the middle of human XAF-1.
XAF1 Rabbit Polyclonal Antibody
TA361295

USD 360.00

5 Days

XAF1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human XAF1
XAF1 Rabbit Polyclonal Antibody
TA361930

USD 360.00

5 Days

XAF1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human XAF1
XAF1 Rabbit Polyclonal Antibody
TA367384

USD 380.00

4 Weeks

XAF1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human XAF1