Antibodies

Jump to Filters
View as table Download
XKRX Rabbit Polyclonal Antibody
TA334914

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-XKRX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XKRX antibody is synthetic peptide directed towards the N-terminal region of Human XKRX. Synthetic peptide located within the following region: FVHRDLAKDKPLSLFMHLILLGPVIRCLEAMIKYLTLWKKEEQEEPYVSL
XKRX (C-term) Rabbit Polyclonal Antibody
AP54586PU-N

USD 450.00

2 Weeks

XKRX (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 316-345 amino acids from the C-terminal region of human XKRX
XKRX Rabbit Polyclonal Antibody
TA351964

USD 345.00

In Stock

Rabbit Polyclonal Anti-NUDC Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human XKRX
XKRX Rabbit Polyclonal Antibody
TA367387

USD 380.00

4 Weeks

XKRX rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human XKRX