Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-XPO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XPO1 antibody: synthetic peptide directed towards the C terminal of human XPO1. Synthetic peptide located within the following region: NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH |
Rabbit Polyclonal Anti-XPO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XPO1 antibody: synthetic peptide directed towards the middle region of human XPO1. Synthetic peptide located within the following region: IPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVP |
CRM1/XPO1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human CRM1/CRM1/XPO1 (NP_003391.1). |
| Modifications | Unmodified |
CRM1/XPO1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human CRM1/CRM1/XPO1 (NP_003391.1). |
| Modifications | Unmodified |
CRM1 (XPO1) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human XPO1 |
XPO1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human XPO1 |
Active filters
Target Symbol
- XPO1