Germany
Japan
United Kingdom
China
Antibodies
View as table Download
XPO7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human XPO7 (NP_055839.3). |
| Modifications | Unmodified |
XPO7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human XPO7 (NP_055839.3). |
| Modifications | Unmodified |
Goat Polyclonal Antibody against XPO7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NSTYGVNSNDMMS, from the C Terminus of the protein sequence according to NP_055839. |
Rabbit Polyclonal Anti-XPO7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XPO7 antibody is: synthetic peptide directed towards the C-terminal region of Human XPO7. Synthetic peptide located within the following region: PLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTK |
Active filters
Target Symbol
- XPO7