YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
Mouse Monoclonal YAP1 Antibody (1A12)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MonoMethyl-YAP1-K342 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic monomethylated peptide around K342 of human YAP1 (NP_001123617.1). |
| Modifications | MonoMethyl K342 |
MonoMethyl-YAP1-K342 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic monomethylated peptide around K342 of human YAP1 (NP_001123617.1). |
| Modifications | MonoMethyl K342 |
Phospho-YAP1-S128 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S128 of human YAP1 (NP_001123617.1). |
| Modifications | Phospho S128 |
Phospho-YAP1-S128 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S128 of human YAP1 (NP_001123617.1). |
| Modifications | Phospho S128 |
Rabbit polyclonal anti-YAP antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human YAP. |
Rabbit Polyclonal YAP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human YAP |
Rabbit Polyclonal YAP (Ser127) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human YAP around the phosphorylation site of Serine 127 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-YAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YAP1 antibody: synthetic peptide directed towards the C terminal of human YAP1. Synthetic peptide located within the following region: QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS |
YAP1 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human YAP1 |
YAP1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 103-133 amino acids from the Central region of human YAP |
Goat Anti-YAP1 Antibody
| Applications | WB |
| Reactivities | Dog |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TYHSRDESTDS, from the internal region of the protein sequence according to NP_006097.1. |
YAP1 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
Non-phospho-YAP1-S127 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human YAP1. |
| Modifications | Unmodified |
phospho-YAP1-S397 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S397 of human YAP1. |
| Modifications | Phospho S397 |
YAP1 mouse monoclonal antibody,clone OTI4G8
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
YAP1 mouse monoclonal antibody,clone OTI5E6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
YAP1 mouse monoclonal antibody,clone OTI6B11
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
