YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
Rabbit polyclonal YB1 (Ser102) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human YB1 around the phosphorylation site of serine 102 (L-R-SP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal YB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody was made against a protein fragment from the entire range of the protein (CAA65446). |
Rabbit polyclonal YBX1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This YBX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 149-178 amino acids from the Central region of human YBX1. |
Rabbit polyclonal YBX1 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This YBX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 276-305 amino acids from the C-terminal region of human YBX1. |
Rabbit Polyclonal Anti-YBX1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-YBX1 Antibody: synthetic peptide directed towards the middle region of human YBX1. Synthetic peptide located within the following region: NHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRR |
Rabbit Polyclonal Anti-NSEP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NSEP1 Antibody: synthetic peptide directed towards the C terminal of human NSEP1. Synthetic peptide located within the following region: NMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNF |
Rabbit Polyclonal Anti-YBX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-YBX1 antibody is: synthetic peptide directed towards the C-terminal region of Human YBX1. Synthetic peptide located within the following region: PYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPP |
Carrier-free (glycerol/BSA-free) YBX1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-YBX1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 310-324 amino acids of human Y box binding protein 1 |
Phospho-YB-1/YBX1-S102 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho synthetic peptide corresponding to residues surrounding S102 of Human YBX1. |
| Modifications | Phospho S102 |
YB1 Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
YBX1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
YBX1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
YBX1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
YBX1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
