Antibodies

Jump to Filters
View as table Download
YES1 Rabbit Polyclonal Antibody
TA383408

USD 275.00

3 Weeks

YES1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human YES1 (NP_005424.1).
Modifications Unmodified
YES1 Rabbit Polyclonal Antibody
TA383408S

USD 85.00

3 Weeks

YES1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human YES1 (NP_005424.1).
Modifications Unmodified
YES1 Rabbit Polyclonal Antibody
TA590206

USD 409.00

In Stock

Rabbit Polyclonal Yes1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
YES1 (284-541) Rabbit Polyclonal Antibody
AP23146PU-N

USD 440.00

2 Weeks

YES1 (284-541) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 284 and 541 of Human c-Yes
YES1 Rabbit Polyclonal Antibody
TA321714

USD 345.00

4 Weeks

Anti-YES1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 10-193 amino acids of human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
YES1 Rabbit Polyclonal Antibody
TA358529

USD 360.00

5 Days

YES1 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTA
YES1 Rabbit Polyclonal Antibody
TA360562

USD 360.00

5 Days

YES1 Antibody - C-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human YES1