Rabbit Polyclonal Anti-YIF1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-YIF1A Antibody is: synthetic peptide directed towards the N-terminal region of Human YIF1A. Synthetic peptide located within the following region: LFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMANVAMAYGSSIASHG |
YIF1A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human YIF1A |
YIF1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human YIF1A |
YIF1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human YIF1A |
Germany
Japan
United Kingdom
China