Antibodies

View as table Download

YRDC rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human YRDC

Rabbit Polyclonal Anti-YRDC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-YRDC antibody is: synthetic peptide directed towards the middle region of Human YRDC. Synthetic peptide located within the following region: VPEGLLKDLLPGPVTLVMERSEELNKDLNPFTPLVGIRIPDHAFMQDLAQ

YRDC rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human YRDC