Antibodies

View as table Download

YWHAQ Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

14-3-3 theta (YWHAQ) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 200-240 of Human 14-3-3 θ.

Goat Polyclonal Antibody against YWHAQ

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DDRKQTIDNSQ, from the internal region of the protein sequence according to NP_006817.1.

Rabbit Polyclonal Anti-YWHAQ Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-YWHAQ antibody: synthetic peptide directed towards the N terminal of human YWHAQ. Synthetic peptide located within the following region: SVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSIC

Rabbit polyclonal anti-14-3-3 theta antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 14-3-3 ?.

Anti-YWHAQ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide

Anti-YWHAQ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide

YWHAQ Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human YWHAQ

14-3-3 theta Rabbit polyclonal Antibody

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human 14-3-3 Theta

14-3-3 θ/τ (phospho-S232) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human 14-3-3 θ/τ around the phosphorylation site of Serine 232