Rabbit Polyclonal Anti-YY1AP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YY1AP1 antibody: synthetic peptide directed towards the middle region of human YY1AP1. Synthetic peptide located within the following region: WTVVKTEEGRQALEPLPQGIQESLNNSSPGDLEEVVKMEPEDATEEISGF |
YY1AP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human YY1AP1 |
YY1AP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human YY1AP1 |
YY1AP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human YY1AP1 (NP_060723.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
