Antibodies

View as table Download

Rabbit Polyclonal Anti-YTHDF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-YTHDF2 Antibody is: synthetic peptide directed towards the C-terminal region of Human YTHDF2. Synthetic peptide located within the following region: WSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLE

Rabbit Polyclonal Anti-YTHDF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-YTHDF2 Antibody is: synthetic peptide directed towards the C-terminal region of Human YTHDF2. Synthetic peptide located within the following region: QEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK

YTHDF2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 550-579 amino acids from the C-terminal region of human YTHD2

YTHDF2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human YTHDF2 (NP_057342.2).