Rabbit Polyclonal Anti-YTHDF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-YTHDF2 Antibody is: synthetic peptide directed towards the C-terminal region of Human YTHDF2. Synthetic peptide located within the following region: WSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLE |
Rabbit Polyclonal Anti-YTHDF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-YTHDF2 Antibody is: synthetic peptide directed towards the C-terminal region of Human YTHDF2. Synthetic peptide located within the following region: QEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK |
YTHDF2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 550-579 amino acids from the C-terminal region of human YTHD2 |
YTHDF2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human YTHDF2 (NP_057342.2). |
Germany
Japan
United Kingdom
China