Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-YY1 antibody(N-term), Loading control
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This YY1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 74-104 amino acids from the N-terminal region of human YY1. |
Rabbit Polyclonal Anti-YY1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YY1 antibody: synthetic peptide directed towards the middle region of human YY1. Synthetic peptide located within the following region: KQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPR |
Rabbit Polyclonal Anti-YY1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YY1 antibody: synthetic peptide directed towards the middle region of human YY1. Synthetic peptide located within the following region: GADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGEN |
Rabbit Polyclonal Anti-YY1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YY1 antibody: synthetic peptide directed towards the N terminal of human YY1. Synthetic peptide located within the following region: MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDD |
YY1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human YY1 |
YY1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human YY1 |
YY1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human YY1 |
YY1 Rabbit polyclonal Antibody
| Applications | ChIP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human YY1 (NP_003394.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- YY1