Rabbit Polyclonal anti-ZBTB20 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB20 antibody: synthetic peptide directed towards the middle region of human ZBTB20. Synthetic peptide located within the following region: SNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQ |
Rabbit Polyclonal Anti-ZBTB20 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB20 antibody: synthetic peptide directed towards the middle region of human ZBTB20. Synthetic peptide located within the following region: QPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPA |
ZBTB20 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZBTB20 |
ZBTB20 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-400 of human ZBTB20 (NP_056457.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
