Rabbit Polyclonal Anti-ZBTB7A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB7A antibody: synthetic peptide directed towards the N terminal of human ZBTB7A. Synthetic peptide located within the following region: MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRS |
Rabbit Polyclonal Anti-ZBTB7A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZBTB7A Antibody: synthetic peptide directed towards the N terminal of human ZBTB7A. Synthetic peptide located within the following region: LSAARLLEIPAVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRA |
Rabbit Polyclonal Anti-ZBTB7A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB7A antibody: synthetic peptide directed towards the middle region of human ZBTB7A. Synthetic peptide located within the following region: PPAERPPTGDGDEGDSNPGLWPERDEDAPTGGLFPPPVAPPAATQNGHYG |
Rabbit Polyclonal Anti-ZBTB7A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZBTB7A antibody is: synthetic peptide directed towards the N-terminal region of Human ZBTB7A. Synthetic peptide located within the following region: MNSLPPAAAAAAASFPWSAFGASDDDLDATKEAVAAAVAAVAAGDCNGLD |
Rabbit Polyclonal Anti-ZBTB7A Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB7A antibody: synthetic peptide directed towards the N terminal of mouse ZBTB7A. Synthetic peptide located within the following region: LEIPAVSHVCADLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF |
Zbtb7a Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
