Antibodies

Jump to Filters
View as table Download
ZDHHC13 Goat Polyclonal Antibody
TA305825

USD 375.00

5 Days

Goat Anti-HIP14L / ZDHHC13 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-FHPAREKVLRSV, from the C Terminus of the protein sequence according to NP_061901.2; NP_001001483.1.
ZDHHC13 Rabbit Polyclonal Antibody
TA335278

USD 310.00

5 Days

Rabbit Polyclonal Anti-ZDHHC13 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZDHHC13 antibody: synthetic peptide directed towards the N terminal of human ZDHHC13. Synthetic peptide located within the following region: MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV
ZDHHC13 (N-term) Rabbit Polyclonal Antibody
AP54635PU-N

USD 450.00

2 Weeks

ZDHHC13 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human ZDHHC13