Antibodies

View as table Download

GODZ (ZDHHC3) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ZDHC3

Rabbit Polyclonal Anti-ZDHHC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZDHHC3 antibody: synthetic peptide directed towards the C terminal of human ZDHHC3. Synthetic peptide located within the following region: MFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASP

ZDHHC3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZDHHC3