Smad Interacting Protein 1 (ZEB2) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 71-120 of Human SIP1. |
Smad Interacting Protein 1 (ZEB2) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 71-120 of Human SIP1. |
Rabbit Polyclonal Anti-ZEB2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZEB2 |
Rabbit Polyclonal Anti-ZEB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the middle region of human ZEB2. Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME |
Rabbit polyclonal anti-ZEB2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZEB2. |
Rabbit Polyclonal ZEB2 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ZEB2 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human ZEB2. |
USD 525.00
2 Weeks
Smad Interacting Protein 1 (ZEB2) (C-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | ZEB2 antibody was raised against an 18 amino acid synthetic near the carboxy terminus of Human ZEB2. |
Rabbit Polyclonal Anti-ZEB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZEB2 Antibody: A synthesized peptide derived from human ZEB2 |
USD 440.00
2 Weeks
Smad Interacting Protein 1 (ZEB2) (N-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide - KLH conjugated |
USD 512.00
2 Weeks
Smad Interacting Protein 1 (ZEB2) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Immunized with a KLH conjugated synthetic peptide between 1078-1105 amino acids from the C-terminal region of human ZEB2 |
Rabbit Polyclonal Anti-ZFHX1B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFHX1B antibody: synthetic peptide directed towards the N terminal of human ZFHX1B. Synthetic peptide located within the following region: NVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALL |
Rabbit Polyclonal Anti-ZEB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the N terminal of human ZEB2. Synthetic peptide located within the following region: SETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEE |
Goat Anti-ZEB2 (aa545-558) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TDSRRQISNIKKEK, from the internal region of the protein sequence according to NP_055610.1; NP_001165124.1. |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI15G8 (formerly 15G8)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 545.00
3 Days
Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody,clone OTI4D12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 545.00
3 Days
Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody,clone OTI1E12
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 545.00
3 Days
Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ZEB2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZEB2 |
ZEB2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1050-1214 of human ZEB2 (NP_055610.1). |
| Modifications | Unmodified |
USD 447.00
In Stock
ZEB2 mouse monoclonal antibody, clone OTI15G8 (formerly 15G8)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
5 Days
ZEB2 mouse monoclonal antibody,clone 15G8, Biotinylated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
5 Days
ZEB2 mouse monoclonal antibody,clone 15G8, HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 200.00
2 Days
ZEB2 mouse monoclonal antibody, clone OTI15G8 (formerly 15G8)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 447.00
In Stock
ZEB2 mouse monoclonal antibody,clone OTI4D12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 4D12, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 4D12, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
ZEB2 mouse monoclonal antibody,clone OTI4D12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 447.00
In Stock
ZEB2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 3D8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 3D8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
ZEB2 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 447.00
In Stock
ZEB2 mouse monoclonal antibody,clone OTI1E12
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
5 Days
ZEB2 mouse monoclonal antibody,clone 1E12, Biotinylated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
5 Days
ZEB2 mouse monoclonal antibody,clone 1E12, HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 200.00
In Stock
ZEB2 mouse monoclonal antibody,clone OTI1E12
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 447.00
In Stock
ZEB2 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 14G3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
ZEB2 mouse monoclonal antibody,clone 14G3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
ZEB2 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |