Antibodies

Jump to Filters
View as table Download
ZFP14 (N-term) Rabbit Polyclonal Antibody
AP54643PU-N

USD 450.00

2 Weeks

ZFP14 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 71-100 amino acids from the N-terminal region of human ZFP14
ZFP14 Rabbit Polyclonal Antibody
TA339743

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZFP14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZFP14 antibody: synthetic peptide directed towards the N terminal of human ZFP14. Synthetic peptide located within the following region: KSYSLQGSIFRNDWECKSKIEGEKEQQEGYFGQVKITSEKMTTYKRHNFL