Rabbit Polyclonal Anti-ZFP28 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFP28 antibody: synthetic peptide directed towards the middle region of human ZFP28. Synthetic peptide located within the following region: RKTFIQIGHLNQHKRVHTGERSYNYKKSRKVFRQTAHLAHHQRIHTGESS |
ZFP28 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZFP28 |
ZFP28 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-349 of human ZFP28 (NP_001295369.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China