Antibodies

Jump to Filters
View as table Download
Zfp384 Rabbit Polyclonal Antibody
TA330201

USD 375.00

5 Days

Rabbit Polyclonal Anti-Znf384 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Znf384 antibody is: synthetic peptide directed towards the N-terminal region of RAT Znf384. Synthetic peptide located within the following region: EKGCGLAPPHYPTLLTVPASVSLSSGISMDTESKSEQLTPHSQASVTQNI