Antibodies

Jump to Filters
View as table Download
ZNF545 (ZFP82) Rabbit Polyclonal Antibody
TA345492

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZNF545 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF545 antibody: synthetic peptide directed towards the C terminal of human ZNF545. Synthetic peptide located within the following region: CRKAFRLNSSLIQHLRIHSGEKPYECKECKKAFRQHSHLTHHLKIHNVKI
ZNF545 (ZFP82) Rabbit Polyclonal Antibody
TA329441

USD 375.00

5 Days

Rabbit Polyclonal anti-ZNF545 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF545 antibody: synthetic peptide directed towards the C terminal of human ZNF545. Synthetic peptide located within the following region: KAFSRYSQLISHQSIHIGVKPYDCKECGKAFRLLSQLTQHQSIHIGEKPY
ZNF545 (ZFP82) Mouse Monoclonal Antibody [Clone ID: OTI5D8]
CF812054

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ZFP82 mouse monoclonal antibody,clone OTI5D8

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
ZNF545 (ZFP82) Rabbit Polyclonal Antibody
TA383484

USD 220.00

3 Weeks

ZFP82 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-170 of human ZFP82 (NP_597723.1).
Modifications Unmodified