Rabbit Polyclonal Anti-ZMAT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZMAT2 antibody: synthetic peptide directed towards the middle region of human ZMAT2. Synthetic peptide located within the following region: KEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY |
Rabbit Polyclonal Anti-ZMAT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZMAT2 antibody: synthetic peptide directed towards the N terminal of human ZMAT2. Synthetic peptide located within the following region: AEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLESKLGKTIVITKTTPQ |
ZMAT2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 161-190 amino acids from the C-terminal region of human ZMAT2 |
ZMAT2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human ZMAT2 (NP_653324.1). |
| Modifications | Unmodified |
ZMAT2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human ZMAT2 (NP_653324.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
