Antibodies

Jump to Filters
View as table Download
ZFP106 (ZNF106) Rabbit Polyclonal Antibody
TA333704

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZFP106 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZFP106 Antibody: synthetic peptide directed towards the N terminal of human ZFP106. Synthetic peptide located within the following region: QKESELQMTSAASPHPGLLLDLKTSLEDAQVDDSIKSHVSYETEGFESAS
ZFP106 (ZNF106) Rabbit Polyclonal Antibody
TA351980

USD 345.00

In Stock

Rabbit Polyclonal Anti-ZNF106 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZNF106
ZFP106 (ZNF106) Rabbit Polyclonal Antibody
TA360881

USD 360.00

5 Days

ZNF106 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP106
ZNF106 Rabbit Polyclonal Antibody
TA385592

USD 380.00

4 Weeks

ZFP106 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ZFP106. AA range:1833-1882