Antibodies

View as table Download

Rabbit polyclonal Anti-ZNF141 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF141 antibody: synthetic peptide directed towards the N terminal of human ZNF141. Synthetic peptide located within the following region: KILQCKASVKVVSKFSNSNKRKTRHTGEKHFKECGKSFQKFSHLTQHKVI

Rabbit Polyclonal Anti-ZNF141 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF141 antibody: synthetic peptide directed towards the N terminal of human ZNF141. Synthetic peptide located within the following region: QCKASVKVVSKFSNSNKRKTRHTGEKHFKECGKSFQKFSHLTQHKVIHAG

Rabbit Polyclonal Anti-ZNF141 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF141 antibody: synthetic peptide directed towards the middle region of human ZNF141. Synthetic peptide located within the following region: KCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIH