Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ZNF169 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF169 antibody: synthetic peptide directed towards the middle region of human ZNF169. Synthetic peptide located within the following region: HQRTHTGEKPYLCPECGRRFSQKASLSIHQRKHSGEKPYVCRECGRHFRY |
Rabbit polyclonal antibody to ZNF169 (zinc finger protein 169)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 247 and 562 of ZNF169 (Uniprot ID#Q14929) |
Rabbit Polyclonal Anti-ZNF169 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF169 antibody: synthetic peptide directed towards the N terminal of human ZNF169. Synthetic peptide located within the following region: EPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIF |
ZNF169 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human ZNF169 (NP_919301.2). |
| Modifications | Unmodified |
ZNF169 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human ZNF169 (NP_919301.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ZNF169