Rabbit Polyclonal Anti-ZNF177 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-ZNF177 antibody: synthetic peptide directed towards the N terminal of human ZNF177. Synthetic peptide located within the following region: MAAGWLTTWSQNSVTFQEVAVDFSQEEWALLDPAQKNLYKDVMLENFRNL |
Rabbit Polyclonal Anti-ZNF177 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-ZNF177 antibody: synthetic peptide directed towards the middle region of human ZNF177. Synthetic peptide located within the following region: AFRNSSCLRVHVRTHTGEKPYKCFQCEKAFSTSTNLIMHKRIHNGQKLHE |
ZNF177 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human ZN177 |
ZNF177 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-110 of human ZNF177 (NP_003442.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China