Rabbit Polyclonal Anti-ZNF254 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF254 antibody is: synthetic peptide directed towards the middle region of Human ZNF254. Synthetic peptide located within the following region: WSSTLTNHRKIYTEEKPYKCEEYNKSPKQLSTLTTHEIIHAGEKLYKCEE |
Rabbit Polyclonal Anti-ZNF254 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF254 antibody: synthetic peptide directed towards the middle region of human ZNF254. Synthetic peptide located within the following region: SKVFQCDKYLKVFYKFLNSNRPKIRHTEKKSFKCKKRVKLFCMLSHKTQH |
Germany
Japan
United Kingdom
China