Rabbit Polyclonal Anti-ZNF264 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF264 antibody: synthetic peptide directed towards the N terminal of human ZNF264. Synthetic peptide located within the following region: AAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLV |
Rabbit Polyclonal Anti-ZNF264 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF264 antibody: synthetic peptide directed towards the C terminal of human ZNF264. Synthetic peptide located within the following region: SGQTSVTLRELLLGKDFLNVTTEANILPEETSSSASDQPYQRETPQVSSL |
Carrier-free (BSA/glycerol-free) ZNF264 mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF264 mouse monoclonal antibody,clone OTI10D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF264 mouse monoclonal antibody,clone OTI10F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF264 mouse monoclonal antibody,clone OTI8G5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF264 mouse monoclonal antibody,clone OTI8E9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF264 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ZNF264 (NP_003408.1). |
| Modifications | Unmodified |
ZNF264 mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF264 mouse monoclonal antibody,clone OTI6F3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF264 mouse monoclonal antibody,clone OTI6F3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF264 mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF264 mouse monoclonal antibody,clone OTI10D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF264 mouse monoclonal antibody,clone OTI10D12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ZNF264 mouse monoclonal antibody,clone OTI10D12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF264 mouse monoclonal antibody,clone OTI10D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF264 mouse monoclonal antibody,clone OTI10F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF264 mouse monoclonal antibody,clone OTI10F5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF264 mouse monoclonal antibody,clone OTI10F5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF264 mouse monoclonal antibody,clone OTI10F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF264 mouse monoclonal antibody,clone OTI8G5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF264 mouse monoclonal antibody,clone OTI8G5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF264 mouse monoclonal antibody,clone OTI8G5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF264 mouse monoclonal antibody,clone OTI8G5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF264 mouse monoclonal antibody,clone OTI8E9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF264 mouse monoclonal antibody,clone OTI8E9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF264 mouse monoclonal antibody,clone OTI8E9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF264 mouse monoclonal antibody,clone OTI8E9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
