Rabbit Polyclonal Anti-ZNF274 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF274 antibody: synthetic peptide directed towards the middle region of human ZNF274. Synthetic peptide located within the following region: SHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQPTS |
Rabbit Polyclonal anti-ZNF274 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF274 antibody: synthetic peptide directed towards the N terminal of human ZNF274. Synthetic peptide located within the following region: YPELQLDPKLDPLPAESPLMNIEVVEVLTLNQEVAGPRNAQIQALYAEDG |
ZNF274 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZNF274 |
Germany
Japan
United Kingdom
China
