Rabbit Polyclonal Anti-ZNF277 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF277 antibody: synthetic peptide directed towards the N terminal of human ZNF277. Synthetic peptide located within the following region: MAASKTQGAVARMQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTT |
Rabbit polyclonal antibody to ZNF277 (zinc finger protein 277)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 99 and 448 of ZNF277 (Uniprot ID#Q9NRM2) |
ZNF277 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZNF277 |
ZNF277 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ZNF277 (NP_068834.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
