Antibodies

View as table Download

Rabbit Polyclonal Anti-ZNF280C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF280C antibody: synthetic peptide directed towards the N terminal of human ZNF280C. Synthetic peptide located within the following region: DDDKPFQPKNISKMAELFMECEEEELEPWQKKVEETQDEDDDELIFVGEI

Rabbit polyclonal anti-ZNF280C antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZNF280C.