Zinc finger protein 30 (ZNF30) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ZNF30 |
Zinc finger protein 30 (ZNF30) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ZNF30 |
Rabbit Polyclonal Anti-ZNF30 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZNF30 antibody: synthetic peptide directed towards the middle region of human ZNF30. Synthetic peptide located within the following region: YECKECGKAFSTSSPLAKHQRIHTGEKPYECKECGKSFTVYGQLTRHQSI |