Rabbit Polyclonal Anti-ZNF317 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF317 antibody: synthetic peptide directed towards the C terminal of human ZNF317. Synthetic peptide located within the following region: HRRIHTGEKPYECLVCGKAFSDHSSLRSHVKTHRGEKLFVSSVWKRLQ |
Carrier-free (BSA/glycerol-free) ZNF317 mouse monoclonal antibody,clone OTI3A8
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF317 mouse monoclonal antibody,clone OTI10C5
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
ZNF317 mouse monoclonal antibody,clone OTI3A8
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF317 mouse monoclonal antibody,clone OTI3A8, Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
ZNF317 mouse monoclonal antibody,clone OTI3A8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
ZNF317 mouse monoclonal antibody,clone OTI3A8
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
ZNF317 mouse monoclonal antibody,clone OTI10C5
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF317 mouse monoclonal antibody,clone OTI10C5, Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
ZNF317 mouse monoclonal antibody,clone OTI10C5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
ZNF317 mouse monoclonal antibody,clone OTI10C5
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China