Rabbit Polyclonal Anti-ZNF326 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF326 antibody: synthetic peptide directed towards the C terminal of human ZNF326. Synthetic peptide located within the following region: GNIQGVGEGGEVGVVGEVEGVGEVEEVEELEEETAKEEPADFPVEQPEEN |
Rabbit Polyclonal Anti-ZNF326 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF326 antibody: synthetic peptide directed towards the N terminal of human ZNF326. Synthetic peptide located within the following region: DFEDDYTHSACRNTYQGFNGMDRDYGPGSYGGMDRDYGHGSYGGQRSMDS |
Rabbit Polyclonal anti-ZNF326 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF326 antibody: synthetic peptide directed towards the C terminal of human ZNF326. Synthetic peptide located within the following region: ENPFEIQDHSQDQQIEGDEEDEEKIDEPIEEEEDEDEEEEAEEVGEVEEV |
ZNF326 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ZNF326. |
Germany
Japan
United Kingdom
China
